CAGEF_services_slide.png

Lecture 05: Of Data Cleaning and Documentation - Conquer Regular Expressions and Challenge yourself with a 'Real' Dataset test


0.1.0 About Introduction to R

Introduction to R is brought to you by the Centre for the Analysis of Genome Evolution & Function (CAGEF) bioinformatics training initiative. This course was developed based on feedback on the needs and interests of the Department of Cell & Systems Biology and the Department of Ecology and Evolutionary Biology.

The structure of this course is a code-along style - it is 100% hands on! A few hours prior to each lecture, links to the materials will be avaialable for download at QUERCUS. The teaching materials will consist of a Jupyter Lab Notebook with concepts, comments, instructions, and blank spaces that you will fill out with R by coding along with the instructor. Other teaching materials include an HTML version of the notebook, and datasets to import into R - when required. This learning approach will allow you to spend the time coding and not taking notes!

As we go along, there will be some in-class challenge questions for you to solve either individually or in cooperation with your peers. Post lecture assessments will also be available (see syllabus for grading scheme and percentages of the final mark) through DataCamp to help cement and/or extend what you learn each week.

0.1.1 Where is this course headed?

We'll take a blank slate approach here to R and assume that you pretty much know nothing about programming. From the beginning of this course to the end, we want to get you from some potential scenarios:

and get you to a point where you can:

data-science-explore.png

0.1.2 How do we get there? Step-by-step.

In the first two lessons, we will talk about the basic data structures and objects in R, get cozy with the RStudio environment, and learn how to get help when you are stuck. Because everyone gets stuck - a lot! Then you will learn how to get your data in and out of R, how to tidy our data (data wrangling), subset and merge data, and generate descriptive statistics. Next will be data cleaning and string manipulation; this is really the battleground of coding - getting your data into the format where you can analyse it. After that, we will make all sorts of plots for both data exploration and publication. Lastly, we will learn to write customized functions and apply more advanced statistical tests, which really can save you time and help scale up your analyses.

Draw_an_Owl-2.jpg

The structure of the class is a code-along style: It is fully hands on. At the end of each lecture, the complete notes will be made available in a PDF format through the corresponding Quercus module so you don't have to spend your attention on taking notes.


0.2.0 Class Objectives

This is the fifth in a series of seven lectures. Last lecture we learned the basics of data visualization with the ggplot2 package. This week we return to the world of data cleaning with a very important tool - the regular expression! At the end of this session you will be able to use tidyverse tools and regular expressions to tidy/clean your data. This week our topics are broken into:

  1. Introduction to data cleaning.
  2. The basic syntax of regular expressions (RegEx).
  3. String manipulation tools via the stringr package.
  4. A step-by-step example for converting a fasta file

0.3.0 A legend for text format in Jupyter markdown

Blue box: A key concept that is being introduced
Yellow box: Risk or caution
Green boxes: Recommended reads and resources to learn R

0.4.0 Lecture and data files used in this course

0.4.1 Weekly Lecture and skeleton files

Each week, new lesson files will appear within your JupyterHub folders. We are pulling from a GitHub repository using this Repository git-pull link. Simply click on the link and it will take you to the University of Toronto JupyterHub. You will need to use your UTORid credentials to complete the login process. From there you will find each week's lecture files in the directory /2021-09-IntroR/Lecture_XX. You will find a partially coded skeleton.ipynb file as well as all of the data files necessary to run the week's lecture.

Alternatively, you can download the Jupyter Notebook (.ipynb) and data files from JupyterHub to your personal computer if you would like to run independently of the JupyterHub.

0.4.2 Live-coding HTML page

A live lecture version will be available at camok.github.io that will update as the lecture progresses. Be sure to refresh to take a look if you get lost!

0.4.3 Post-lecture PDFs and Recordings

As mentioned above, at the end of each lecture there will be a completed version of the lecture code released as a PDF file under the Modules section of Quercus. A recorded version of the lecture will be made available through the University's MyMedia website and a link will be posted in the Discussion section of Quercus.


0.4.4 Data used in this session

Today we have 2 data files to help us work through the concepts of data cleaning with regular expressions.

0.4.4.1 Datafile 1: data/regex_word.docx

This is an example file for us to start playing with the idea of regular expressions.

0.4.4.2 Datafile 2: data/FoxP2_primate.fasta

This is the main file that we'll be working with for the rest of the lecture. We'll search, replace, and manipulate data from this file after importing it into our notebooks.


0.5.0 Packages used in this lesson

The following packages are used in this lesson:

Some of these packages should already be installed into your Anaconda base from previous lectures. If not, please review that lesson and load these packages. Remember to please install these packages from the conda-forge channel of Anaconda.


1.0.0 Data cleaning or "data munging" or "data wrangling"

In previous weeks the data cleaning we've worked with has been more in the realm of data management - moving columns, converting from wide to long format, and making new variables. We've been more focused on getting the data into a proper format for analysis. Aside from splitting multi-variable columns apart, however, we have done very little to alter the raw data values and headings themselves.

Why do we need to do this?

'Raw' data is seldom (never) in a usable format. Data in tutorials or demos have already been meticulously filtered, transformed and readied to showcase that specific analysis. How many people have done a tutorial only to find they can't get their own data in the format to use the tool they have just spent an hour learning about?

Data cleaning requires us to:

Some definitions might take this a bit farther and include normalizing data and removing outliers. In this course, we consider data cleaning as getting data into a format where we can start actively exploring our data with graphics, data normalization, etc.

Today we are going to mostly focus on the data cleaning of text. This step is crucial for taking control of your dataset and your metadata. I have included the functions I find most useful for these tasks but I encourage you to take a look at the Strings Chapter in R for Data Science for an exhaustive list of functions. We have learned how to transform data into a tidy format in lectures 2 and 3, but the prelude to transforming data is doing the grunt work of data cleaning. So let's get to it!

![cleaning.gif](attachment:cleaning.gif)

2.0.0 Introduction to regular expressions (RegEx)

"A God-awful and powerful language for expressing patterns to match in text or for search-and-replace. Frequently described as 'write only', because regular expressions are easier to write than to read/understand. And they are not particularly easy to write." - Jenny Bryan

RegEx is a very sophisticated way to find, replace, and extract information from strings.

For our first regex exercise, use Microsoft Word to open the file "regex_word.docx". This file contains one string: "Bob and Bobby went to Runnymede Road for a run and then went apple bobbing.". Here is what we are going to do:

xkcd-1171-perl_problems.png


2.0.1 Regular expressions can be your friends

So why do regular expressions or 'RegEx' get so much flak if it is so powerful for text matching? Scary example: how to get an email in different programming languages http://emailregex.com/.

Writing/reading Regex is definitely one of those situations where you should annotate your code. There are many terrifying urban legends about people coming back to their code and having no idea what their code means.

![yesterdays-regex.png](attachment:yesterdays-regex.png)

There are sites available to help you make up your regular expressions and validate them against text. These are usually not R specific, but they will get you close and the expression will only need a slight modification for R (like an extra backslash - described below).

ReGex testers:

https://regex101.com/
https://regexr.com/

Today we will be practicing RegEx at Simon Goring's R-specific demo tester:
https://simongoring.shinyapps.io/RegularExpressionR/

What does the language look like?

The language is based on meta-characters which have a special meaning rather than their literal meaning. For example, '\$' is used to match the end of a string, and this use supersedes its use as a character in a string (i.e. 'Joe paid \$2.99 for chips.').


2.1.0 Classes are groups of reserved characters

What kind of character is it? Classes identify specifically reserved groups of characters and are used as a quick way to represent them. There are two ways to define classes - either using special "escaped" characters denoted with a \ or using the [ ] notation within a regular expression.

Expression Meaning
\w, [A-z, 0-9], [[:alnum:]] word characters (letters + digits)
\d, [0-9], [[:digit:]] digits
[A-z], [[:alpha:]] alphabetical characters
\s, [[:space:]] space
[[:punct:]] punctuation
[[:lower:]] lowercase
[[:upper:]] uppercase
\W, [^A-z0-9] not word characters
\S not space
\D, [^0-9] not digits

Note that some of these are not universal but rather specific to POSIX bracket expression ie [:xx:] and must be used within a secondary set of brackets to be valid. This kind of syntax is compatible with many regex systems including R and Unix.


2.2.0 Quantifiers denote repetition of patterns

When we are thinking about patterns, we may expect the repetition of patterns within patterns. To account for this as a language, regular expressions use quantifiers to denote the presence or absence of specific patterns. In other words, we use quantifiers to answer "How many times will a character appear?"

Expression Meaning
? 0 or 1 occurrence
* 0 or more occurrences
+ 1 or more occurrences
{n} exactly n occurrences
{n,} at least n occurrences
{,n} at most n occurrences
{n,m} between n and m occurrences (inclusive)

2.3.0 Operators are helper actions

You may recall from lecture 3 that we encountered the idea of conditional operators. Regular expressions can also rely on the | OR operator to denote that a subpattern or it's alternative must be present. Additional operators are used to classify character groups. Much like in classes, we can define specific groups of characters to look for within our patterns. Overall, the operators can be thought of as helper actions to match your characters.

Expression Meaning
| or
. matches any single character
[ ... ] matches ANY of the characters inside the brackets
[ ... - ... ] matches a RANGE of characters inside the brackets
[ ^... ] matches any character EXCEPT those inside the bracket
( ... ) grouping - used for [backreferencing] (https://www.regular-expressions.info/backref.html)

2.4.0 Matching to the start or end of a string

Recall we are working with strings - these can be long or short but they all have a start and an end. Sometimes the patterns we are concerned with are located at the beginning or end of a string (think prefixes and suffixes). We use special position-matching characters to denote these ideas.

Expression Meaning
^ start of the string
$ end of the string
\\b empty string at either edge of the word
\\B empty string that is NOT at the edge of a word

2.5.0 Metacharacters must be escaped with \

This can be one of the hardest concepts with regular expressions but remember that we just went over multiple lists where characters had their own meaning like $ or (. These are called metacharacters because they have meaning beyond just representing string characters. To a regular expression they initiate a specific kind of analysis of the characters that follow.

Escape sequences \, however, allow you to use a character 'as is' rather than its special RegEx function. In R, RegEx are evaluated as strings first, then as a regular expression unless we specify we are writing a regular expression. A backslash is used to escape each RegEx character in the string, so often we will need 2 backslashes to escape. For instance if we want to use the string $100 in a RegEx search term, then we need to tell R that we just want to work with the character $ and not look for the pattern 100 at the end of a string.

If we used \$100 we wouldn't get what we want because the \ is also a metacharacter that needs be interpreted as a slash first by R! Instead we must use \\$100: one backslash (escape character) per character, so at the end we end up with a RegEx that looks like \\$. To the RegEx function, however, we've only provided \$.

Expression Meaning
\\ escape for meta-characters to be used as characters (*, $, ^, ., ?, |, \, [, ], {, }, (, )).
Note: the backslash is also a meta-character.

2.6.0 Trouble-shooting RegEx

Trouble-shooting with escaping meta-characters means adding backslashes until something works.

Joking/Not Joking (xkcd)

While you can always refer back to this lesson for making your regular expressions, you can also use this RegEx cheatsheet.



3.0.0 Online ReGex exercise

Now that we have some basic ideas and terms under our belts, let's get to working with actual regular expressions. We will kick ofF this RegEx lecture by playing around with an online tool: https://regexr.com/.

3.1.0 Breaking down a regular expression example

In the text section of the online tool, replace the default text by:

>NP_001009020.1 forkhead box protein P2 [Pan troglodytes] MMQESATETISNSSMNQNGMSTLSSQLDAGSRDGRSSGDTSSEVSTVELLHLQQQQALQAARQLLLQQQT SGLKSPKSSDKQRPLQVPVSVAMMTPQVITPQQMQQILQQQVLSPQQLQALLQQQQAVMLQQQQLQEFYK

We are going to explore the following expression by breaking it down into its components: ^>(\w+)\.(\d)\s(.+)\[(\w+)\s(\w+).*\]

What do you think it matches in our text?

3.1.1 The breakdown:

Expression Meaning
^ Beginning of a line
> Greater than symbol, used to designate the beginning of a new read in fasta format
\w Match a word (alphabetic) character (Remember that a second escape character (backslash) is required)
+ Match the preceding metacharacter more than once
. match a literal period
\d Match a digit
\s space
.+ anything, one or more times
\[ match a literal squared bracket
.* anything, as many times it is present

3.2.0 Introduction to string manipulation with stringr

Common uses of string manipulation are: Searching, replacing or removing (making substitutions), and splitting and combining substrings.

Base R offers a variety of built-in RegEx functions such as grep(), grepl(), and gsub() that are common to other programming languages. Even though these functions are computationally very efficient, it can be very challenging to master their use. Tidyverse's stringr package offers a more comprehensive, user-friendly set of RegEx-compatible functions that are easier to work with for those unfamiliar with regular expressions. Thus, we will stick to stringr to get some hands-on RegEx experience.

As an example, we are going to play with a string of DNA.


This piece of DNA is from the book Jurassic park, and was supposed to be dinosaur DNA, but is actually just a cloning vector. Bummer.

dino.notdino.png


3.2.1 RStudio's find-replace

RStudio and Jupyter notebooks have their own RegEx-compatible find-replace functionality in its graphic user interface (GUI) that you can use. In Jupyter you can find this on the menu under Edit > Find and Replace. As a quick example, let's find out where in this notebook we can find the string GCGTTGCTGGCG. You can also check other boxes if your search is case sensitive or if you are looking for whole words.

3.2.2 Remove unwanted text with str_remove() and str_remove_all()

Our string "dino" is in FASTA format, but we don't need the header; we just want to deal with the DNA sequence. The header begins with '>' and ends with a number, '1200', with a space between the header and the sequence. Let's practice capturing each of these parts of a string, and then we'll make a regular expression to remove the entire header.

All stringr functions take in as arguments the string you are manipulating and the pattern you are capturing. str_remove replaces the matched pattern with an empty character string "". In our first search we remove '>' from our string, dino.

Evaluate multiple strings: All of our examples use a single string as input to search. You can, however, apply many of these stringr functions to multiple string simultaneously using a character vector like c(string_1, string_2, .., string_n).

Next we can search for numbers. The expression '[0-9]' is looking for any number. Always make sure to check that the pattern you are using gives you the output you expect.


3.2.2.1 str_remove() replaces the first instance of a search string versus str_remove_all()

Why aren't all of the numbers replaced? str_remove only replaces the first match in a character string. Switching to str_remove_all replaces all instances of matches in the character string.


3.2.2.2 Reminder to escape your escape characters

How do we capture spaces? The pattern \s replaces a space. However, for the backslash to not be used as an escape character (its special function), we need to add another backslash, making our pattern \\s. In other words, you need to escape the backslash itself with another backslash.


3.2.2.3 Combine search terms into a single string

To remove the entire header, we need to combine these patterns. Remember, we are really just converting the header string into a simple description - what are the base components of the header and what pattern do they follow?

The header is everything in between > and the number 1200 followed by a ` (space). The operator.captures any single character and the quantifier*` matches it any number of times (including zero).


3.2.3 Greedy vs. lazy matching

>DinoDNA from Crichton JURASSIC PARK p. 103 nt 1-1200 GCGTTGCTGGCGTTTTTCCATAGGCTCCG...

versus

>DinoDNA from Crichton JURASSIC PARK p. 103

You may have noticed that we also have a number followed by a space earlier in the header, '103 '. Why didn't the replacement end at that first match? The first instance is an example of greedy matching - it will capture the longest possible string.

To curtail this behavior and use lazy matching - the shortest possible string - you can add the ? quantifier. Remember that this metacharacter can already signify looking for 0 or 1 occurences of a pattern.

In this case, we are going to use it to make the preceding quantifier * lazy by causing it to match as few character as possible while still matching the remainder of the pattern.

The concepts of greediness and lazyness also play a part in why stringr has seemingly redundant functions such as str_extract() and str_extract_all(), or str_view() and str_view_all(), among others.

In this case, we want the greedy matching to replace the entire header. Let's save the headerless dna sequence into its own object.


3.3.0 Assign raw string literals with r"( )" to simplify your expressions

Now that we've walked through the complex process of separating our FASTA header from our DNA sequence, we can appreciate some of the finer nuances with using regular expressions. The biggest hurdle is always the process of escape characters. For instance in section 3.2.2.2 we emphasized the importance of identifying the common blank space in our string using \\s - even though we know that the metacharacter for a space is \s. Of course things can get quite complicated if our source string also has metacharacters! Take a look at the following example code:


If we wanted to search through that string for the substring that include \\s what is our regular expression? Let's try to find u\\s to convince ourselves that we're getting the right part of the substring. We'll use the str_remove() function to help us out.

As of R version 4.0.0 and above, the ability to produce raw string literals has been added. What does that mean? It means that instead of having to use additional \ escape characters for escape characters, we can use the regular expression as intended to search for the exact pattern you want.

We initiate a raw string literal with the syntax r"(your_regex_here)". That means we need to enclose our regex pattern within both a set of double quotes, and parentheses "( )" while also including the prefix r. While not a perfect solution as we'll see later in section 4.2.5 when working with capture groups, this does offer some simplification when working with RegEx in R.

Let's see how we would code the above example and our original dino sequence example


3.4.0 Extracting to save for later with str_extract()

We may also want to retain our header in a separate string. str_extract() Will retain the string that matches our pattern instead of removing it. We can save this in an object called header. Note that we have removed the final space \\s from our expression because it's more of a separator between header and sequence.


3.5.0 Searching with str_extract_all()

Now we can look for patterns in our (dino) DNA!

Does this DNA have balanced GC content? We can use str_extract_all to capture every character that is either a G or a C.

The output is a list object in which is stored an entry for each G or C extracted. We count the number of occurrences of G and C using str_count and divide by the total number of characters in our string to get the %GC content.


3.6.0 Replacement using str_replace_all()

Let's translate this into mRNA!

To replace multiple patterns at once, a named character vector is supplied to str_replace_all() of patterns and their matched replacements. This allows us to perform multiple replacements multiple times. If you wanted to replace just the first instance of a match, you would use str_replace() instead.

Both str_replace*() functions include the argument replacement in addition to string and pattern. In this case, however, our named character vector is provided to the pattern argument.


3.7.0 Useful search tools powered by RegEx

How do we query our sequence for the presence of specific patterns or motifs?

3.7.1 Simple questions with str_detect()

Is there even a start codon in this sequence? str_detect can be used to return a logical (TRUE or FALSE) vector to whether or not a match is found.


3.7.2 Counting pattern matches with str_count()

It might be more useful to know exactly how many possible start codons we have. str_count() will count the number of matches in the string for our pattern.


3.7.3 Locate pattern matches with str_locate()

To get the position of a possible start codon we can use str_locate(), which will return the indices (coordinates) of where the start and end of our FIRST substring occurs. Values are returned in a 2-column matrix.

str_locate_all() can be used to find all possible locations but a list of 2-column matrices is returned, using a different matrix for each input string.


3.8.0 Splitting up our string with str_sub()

Sometime rather than keeping or discarding a portion of a string and it's pattern, you may want to split the data using a specific regular expression.

Let's split our mrna sequence into substrings of codons, starting at the position of our start codon. We have the position of our start codon from str_locate(). We can use str_sub( to subset the string by position (we will just go to the end of the string for now).

str_sub(string, start, end) where


3.9.0 Applying our RegEx skills further

3.9.1 Generate codons from the first open reading frame with a ...

Remember that . represents any character so we can get codons by extracting groups of (any) 3 nucleotides/characters in our reading frame. Note that these methods search for non-overlapping pattern matches.


3.9.1.1 Remember some functions return a list as output.

Why is the length of our str_extract_all output just a 1? The codons are extracted into a list, but we can get our character substrings using unlist().


3.9.2 Search for multiple specific patterns using |

We now have a vector with 370 codons. Do we have a stop codon in our reading frame?

Remember we've seen a couple of ways to search for multiple patterns in a single RegEx call. Let's check with str_detect(). We can use round brackets ( ) in our search pattern to separately group the different stop codons. We'll use the | (OR) metacharacter to search for the occurence of any of our 3 stop codon sequences.

Notice how in this case we are supplying a character vector codons?


3.9.3 Identify specific occurrences in a vector with which()

Looks like we have many matches. We can subset the codons using str_detect() (instances where the presence of a stop codon is equal to TRUE) to see which stop codons are represented.

Recall from Lecture 01 that we can use the which() function to find which indices the stop codons are positioned at. The call comes in the format of which(data_vector LOGICAL/BOOLEAN desired_value) where:

Let's subset codons to end at the first stop codon.


3.9.4 Replace your codons with amino acids

After finding our unique codons, we can translate codons into their respective proteins by using str_replace_all using multiple patterns and replacements as before.


3.9.5 Collapsing your results into a single string with str_flatten()

What is our final protein string? str_flatten allows us to collapse our individual protein strings (or any character vector) into one long string.


3.9.6 Recombining strings with str_c()

We can add our header back using str_c, which allows us to combine strings. We can use a space to separate our original strings with the sep parameter.


4.0.0 Multi FASTA file formatting

Now that we've walked through some of the basic functions that utilize RegEx, let's try some more advanced examples.

Regex_Scientist.jpeg

In the next exercise, we convert a multifasta file into a csv file that can be viewed in spreadsheet software such as MS Excel. Here are the instructions:

4.0.1 If you wanted to pull down your own version of the data set

Luckily for you, the data is already in your folders but if you wanted to get the data yourself, it would go something like this.


4.1.0 Reorganizing a multi-entry fasta file

Goal: Reorganize the data from a fasta format into a spreasheet format with one row per entry (gene) and the following columns:

For example, given the entry

>NP_001009020.1 forkhead box protein P2 [Pan troglodytes]\r\n MMQESATETISNSSMNQNGMSTLSSQLDAGSRDGRSSGDTSSEVSTVELLHLQQQQALQAARQLLLQQQT\r\n SGLKSPKSSDKQRPLQVPVSVAMMTPQVITPQQMQQILQQQVLSPQQLQALLQQQQAVMLQQQQLQEFYK\r\n

The expected 5-part output would be

Once the file is in the desired format, write the file to disk in CSV format.

In MS Excel, it should be organized something like

Accession_number Protein_info Genus Species Sequence
NP_001009020.1 forkhead box protein P2 Pan troglodytes MMQESATETISNSSMNQNGMST...

Let's do it!


4.1.1 Read in your file as a single string using readr::read_file()

First, we need to read in the file that we just downloaded. We'll use the read_file() function from the readr package which is already imported with the tidyverse. The read_file() function is used to read a complete file into a single character vector - aka one long string.


4.1.2 Explore your data to understand its structure

Before we start manipulating our data, let's inspect fasta. You'll notice from above that there are \r\n characters interspersed throughout the string which are translated as line breaks.

We already know it has 104,129 characters but let's double check the properties of the fasta object.


4.1.2.1 Use writelines() or cat() to see your output in a human-readable format

Right now our data is in a character vector but it's just a single long character. We can't even see it properly withstr() or glimpse(). We tried the print() function but it did not account for line breaks.

The writelines() function, however, will allow us to see the data in a more understandable format. The cat() function will also interpret \n characters but it technically also puts multiple entries from a vector together with a sep= parameter.

To save on output space, we'll limit fasta to just the first 2000 lines as we did with print.


4.1.3 How many entries do we have?

Given that we know that > represents the beginning of an entry in fasta format, we can count the number of > as a proxy for total entries. Recall which function we can use to help count?

It looks like we have 130 entries. It's actually 129 but we'll get to that problem eventually. Time to work in our tasks!


4.2.0 Identify a structural pattern and come up with a plan

Now that we know more about the nature of our fasta information, we can put together a plan for how we want to transform (parse) it into our final format. We see that:

Why \r\n? Due to some historical differences between operating systems, there are three possible combinations of metacharacters to represent a newline. Unix and the newer Mac OS use \n (newline), the old Mac OS used \r (carriage return), and Windows uses \r\n. Across operating systems, the unused metacharacters are usually silently ignored. As a consequence of this diversity, most internet text files (including FASTA) will have the \r\n format for newlines but even Windows can silently interpret a lone \n as a newline. Suffice to say, when creating new lines, you can use \n for simplicity and it should work across most systems. If you're interested in more about this quirk, check it out on Wikipedia.

Let's use the following plan to set our order of operations.

  1. Remove the square brackets we see for each species ie [Homo sapiens]
  2. Split each entry into separate rows
  3. Remove the > symbol from each entry
  4. Split each entry into a "header" and "sequence" portion
  5. Further subdivide the header into the components we want
  6. Clean up the sequences so they are each single strings uninterrupted by line breaks

First let's prepare a second variable subfasta which contains a smaller portion of our entries


4.2.1 Strip out and replace all occurences of [ and ]

The best way to go through the entire string is to use str_replace_all()


4.2.2 Split each entry into an individual row

Each entry is separated by a few characters. If we had printed the output instead to take a closer look at the end of each entry we would see ...PELEDDREIEEEPLSEDLE\r\n\r\n>NP_683697.2. Contrast this to the characters between lines of amino acid sequence which are just \r\n. Can we take advantage of this difference?

We can use str_split() but what pattern should we give it?

str_split() returns a list but we want to work with a vector! Let's quickly fix that.


4.2.3 Remove the > from the start of each entry

Remember each entry is now separately stored in a character vector. We want to go through each and remove the > symbol. To accomplish this we will use str_replace_all which expects a character vector as input. Perfect!


4.2.4 Split your entries into a header and sequence with str_split_fixed()

Now we want to break away our header from the rest of the actual amino acid sequence in each entry. To accomplish this we'll use str_split_fixed(string, pattern, n) where:

At this point we'll switch back to using the full fasta string and save the resulting output into a new variable called header_seq_fasta. The function str_split_fixed() will return a character matrix with n columns.


4.2.4.1 Remove duplicated() entries with the help of which()

Okay, a quick side trip to remind/show you some of the tricks you can use in your data wrangling. Are there duplicated entries in our original fasta file? Perhaps there are unique entry headers but sequences may be duplicated. Let's cull them from the set for now.

How do we check which entries are duplicates of sequences already present in fasta?


4.2.4.2 Remove duplicated() entries with the help of filter()

Rather than use the more complicated code above, we can rely on dplyr to help us out with a call to filter() instead. In this case, recall that we want to filter for the non-duplicated entries. We can accomplish this with the logical not ! annotation.

Again we'll save the final filtered result into the variable header_seq_subset.


4.2.5 Break up the header column into the components that we want

Let's review. We now have a filtered data frame consisting of 2 columns. The first represents the headers from each fasta entry, and the second column contains the sequences of the fasta entry. Let's break our header into the components we wanted:

We'll accomplish this with str_match_all() which takes in our string and returns a list of our matched groups in a vectorised format. The key here is in the pattern where each group is defined by the matching pattern within each set of ( ) (parentheses). Let's keep in mind that the return output of str_match_all() will be a list of character matrices where the first column in each has the complete match, and each additional column is reserved for matching groups as defined above. If multiple matches are identified in the same header text it will produce a matrix with additional rows. Each header entry will result in a new list entry within the str_match_all() output.

In this case we are also going to take advantage of greedy matching to capture protein_info which may take any non-uniform format!

XP_007980836.1 PREDICTED: forkhead box protein P2 isoform X2 Chlorocebus sabaeus

Let's break this header down into some subcomponents which are all separated by whitespace

Text Entry Properties
XP_007980836.1 alphanumeric series, separated by ".", ending with digits
PREDICTED: forkhead box protein P2 isoform X2 alphanumeric with any number of words and spaces present
Chlorocebus single alphabetical word
sabaeus single alphabetical word

4.2.6 Reformat our header information into a data frame

We now have a list of 1x5 matrices where we only car about the information in column 2-5 of each matrix. How do we pull that information from each entry of the list itself? Currently fasta_header exists as a list where each element is a matrix. Let's convince ourselves in the following code cell.


How do we approach converting this to something like a data frame? There are a number of ways to do this and we'll show you a couple.

  1. Remove the unwanted entry as we build the data frame
  2. Convert the list to a data frame and remove the unwanted columns

4.2.6.1 A note about working with data frames and rbind()

There are a number of ways to add a row to a data frame. What must always be remembered is that to add a row, two criteria must be met:

  1. The number of columns must match
  2. The names of the columns must match

Otherwise, the program may not stop but it will certainly not give you the output you were expecting.

A great way to add rows is with the rbind() command. Behind the scenes, when we call this command, the interpreter evaluates the inputs for the call and decides on which implementation of rbind() to use i.e. is this for a data frame? or a matrix? etc. In our case, we will explicitly call on rbind.data.frame() to ensure we get a data.frame as a result.


4.2.6.2 Use a loop to build your data frame one row at a time

We want to repeat the above command for every entry within fasta_header. We haven't discussed loops yet, but will delve into these control structures in a future lecture. Here, however, we want to quickly use it to accomplish a repetitive action. Remember our rules for adding rows to a data frame!


4.2.6.3 do.call() to save youself some trouble

The do.call() function "constructs and executes a function call from a name or a function and a list of arguments to be passed to it." It takes the form of:

do.call(what, args, quote=FALSE, envir = parent.frame())

where

How does this help us? Although not exactly the same, it works very similary to a lapply() function where we can provide a list and it will vectorize a function over that list. The distinction, however, is under the hood where lapply() will apply the same function to each element of a list, do.call will supply a list of arguments just one time to a function call. Furthermore, lapply() always returns a list versus do.call() which will return an object based on the function called.

Overall, that means we can do this...

Don't forget to rename your columns!


4.2.7 Reformat our sequence entries with str_*() methods

Our sequence entries in header_seq_subset are full of line breaks in the form of \r\n and we don't want these anymore. So how can we go about removing those easily?

There are a number of approaches we could take but let's use the tools we've already encountered:

  1. str_split()
  2. str_flatten()

4.2.8 Adding columns to your data frame - a tool for each purpose

It's the last step. We want to add our final sequence information to header.df but there are a number of ways to perform this last step based on what we've learned. Remember we also want to have the new column named "Sequence"

  1. A for loop... but that's more coding than we need
  2. cbind() can add to our data frame
  3. Using $ to create a new variable/column directly in header.df
  4. Use a dplyr verb to create a new column

Let's try some of them!


We're done! Just like we wanted it:

Accession_number Protein_info Genus Species Sequence
NP_001009020.1 forkhead box protein P2 Pan troglodytes MMQESATETISNSSMNQNGMST...

And now you've started your RegEx journey!

Matrix_regex.jpeg


5.0.0 Class summary

That's the end for our fifth class on R! You've made it through Regular Expressions and we've learned about the following:

  1. Regular expression classes, quantifiers, and operators
  2. The stringr package and its RegEx-based functions
  3. How to break down complex patterns into regular expressions
  4. How to parse and convert a multi FASTA file into a data frame

5.1.0 Post-lecture assessment (12% of final grade)

Soon after the end of this lecture, a homework assignment will be available for you in DataCamp. Your assignment is to complete all chapters from the String manipulation in R with stringr course (5150 points total). This is a pass-fail assignment, and in order to pass you need to achieve a least 3,863 points (75%) of the total possible points. Note that when you take hints from the DataCamp chapter, it will reduce your total earned points for that chapter.

In order to properly assess your progress on DataCamp, at the end of each chapter, please take a screenshot of the entire course summary. You'll see this under the "Course Outline" menubar seen at the top of the page for each course and you'll want to expand each section. It should look something like this:

DataCampIntroR.jpg

You may need to take several screenshots if you cannot print it all in a single try. Submit the file(s) or a combined PDF for the homework to the assignment section of Quercus. By submitting your scores for each section, and chapter, we can keep track of your progress, identify knowledge gaps, and produce a standardized way for you to check on your assignment "grades" throughout the course.

You will have until 13:59 hours on Thursday, October 21st to submit your assignment (right before the next lecture).


5.2.0 Acknowledgements

Revision 1.0.0: materials prepared in R Markdown by Oscar Montoya, M.Sc. Bioinformatician, Education and Outreach, CAGEF.

Revision 1.1.0: edited and preprared in Jupyter Notebook by Calvin Mok, Ph.D. Bioinformatician, Education and Outreach, CAGEF.


5.3.0 Your DataCamp academic subscription

This class is supported by DataCamp, the most intuitive learning platform for data science and analytics. Learn any time, anywhere and become an expert in R, Python, SQL, and more. DataCamp’s learn-by-doing methodology combines short expert videos and hands-on-the-keyboard exercises to help learners retain knowledge. DataCamp offers 350+ courses by expert instructors on topics such as importing data, data visualization, and machine learning. They’re constantly expanding their curriculum to keep up with the latest technology trends and to provide the best learning experience for all skill levels. Join over 6 million learners around the world and close your skills gap.

Your DataCamp academic subscription grants you free access to the DataCamp's catalog for 6 months from the beginning of this course. You are free to look for additional tutorials and courses to help grow your skills for your data science journey. Learn more (literally!) at DataCamp.com.

DataCampLogo.png


5.4.0 Resources

http://stat545.com/block022_regular-expression.html
http://stat545.com/block027_regular-expressions.html
http://stat545.com/block028_character-data.html
http://r4ds.had.co.nz/strings.html http://www.gastonsanchez.com/Handling_and_Processing_Strings_in_R.pdf
http://www.opiniomics.org/biologists-this-is-why-bioinformaticians-hate-you/
https://figshare.com/articles/Wellcome_Trust_APC_spend_2012_13_data_file/963054 >
http://emailregex.com/
https://regex101.com/
https://regexr.com/
https://www.regular-expressions.info/backref.html
https://www.regular-expressions.info/unicode.html
https://www.rstudio.com/wp-content/uploads/2016/09/RegExCheatsheet.pdf
https://simongoring.shinyapps.io/RegularExpressionR/


6.0.0 Appendix: A real messy dataset challenge

I looked for a messy dataset for data cleaning and found it in a blog titled:
"Biologists: this is why bioinformaticians hate you..."

Challenge:

This is Wellcome Trust APC dataset on the costs of open access publishing by providing article processing charge (APC) data.

https://figshare.com/articles/Wellcome_Trust_APC_spend_2012_13_data_file/963054

The main and common issue with this dataset is that when data entry was done there was no structured vocabulary; people could type whatever they wanted into free text answer boxes instead of using dropdown menus with limited options, giving an error if something is formatted incorrectly, or stipulating some rules (i.e. must be all lowercase, uppercase, no numbers, spacing, etc).

What I want to know is:

  1. List 3 problems with this dataset that require data cleaning.
  2. What is the mean cost of publishing for the top 3 most popular publishers?
  3. What is the number of publications by PLOS One in dataset?
  4. Convert sterling to CAD. What is the median cost of publishing with Elsevier in CAD?

The route I suggest to take in answering these question is:

There is a README file to go with this spreadsheet if you have questions about the data fields.

</br>

The blogger's opinion of cleaning this dataset:

'I now have no hair left; I’ve torn it all out. My teeth are just stumps from excessive gnashing. My faith in humanity has been destroyed!'

Don't get to this point. The dataset doesn't need to be perfect. No datasets are 100% clean. Just do what you gotta do to answer these questions.

We can talk about how this went at the beginning of next week's lecture.


And we are done for the day! Well done!


6.1.0 Just for fun

There are some other things you can do with special codes and characters. Here are some other uses for writeLines() and cat() functions

CAGEF_new.png